Activated by cyclic tetraadenylate (cA4) to endonucleolytically degrade linear RNA; when cA4 levels decrease the RNase activity of Csx1 is abrogated.

Belongs to the CRISPR-associated Csx1 family.

377 amino acids

MASIVFSTIGNPKGYQKVTYEIDGEKFESNVSVLALRDLLKVDKTVVILGISVADVYNCKYADYRSCKECIIQNSKNDLGISESYVVAPNVYQKFKGKPDHYFTYIYYHSLRILEKEGINEVFIDTTHGINYMGVLAKEAIQLAVSAYAAKSEKEVKVSLYNSDPVGKDVSDTVKLHEIEAIKISPLSGLKYVTYQILNKDKNFFNKIFSDSVNAIPRFATALDNGLFIYLSEKDSSLHLKRLEDDLSKDPLLTPSENEINVVYKDMKYALSHALFYVISRFSGNVDLDTLRHYAETYADKVTRAIIENEVDKIEKYQMGSERKLLGEYMKVEGKGFDKRILYAHGGLPYAGTYVYKEKDKVYVTYGDKIDEIERQI

42.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make csx1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here