Functions as downstream effector of Rho-related GTP binding proteins of the Rho of Plants (ROPs) family. Participates in the propagation of ROP GTPase signals in specific cellular responses. Is involved in pollen tube growth regulation through its interaction with ARAC11/ROP1.

212 amino acids

MQLTMSSSKMKSLLKGLRYISQVFESEKEEEIQIGNPTDVKHVAHIGWDGPSANATAPSWMTEFNSGGGFESAEGVGEDDSSIKCMSEYGGRSRDLPNLPKSTRKAASEKGSPTKDKSSDKTKRRSSNKGTSSSSRRPKEATEEQDELSSWPSGLPEIPKKSRRKKKSTKETAVNGGSSRSTRRSDVDNMSEYMSETGSVRSMPQFDNRDDF

23.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make RIC6 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here