Description
Functions as downstream effector of Rho-related GTP binding proteins of the Rho of Plants (ROPs) family. Participates in the propagation of ROP GTPase signals in specific cellular responses. Required for actin cortical microfilament assembly. Activated by ARAC4/ROP2 to promote the assembly of cortical actin microfilaments required for lobe formation and lateral expansion of pavement cells. Interaction with, and activation by ARAC4/ROP2 is inhibited by RIC1. Functions as downstream effector of ARAC11/ROP1 to promote the assembly of apical F-actin associated with vesicle accumulation in the tip of the growing pollen tube. Counteracts the ARAC11/ROP1-RIC3 pathway, which activates calcium signaling that leads to apical F-actin disassembly associated with exocytosis, to control actin dynamics and pollen tube apical growth. Downstream of ARAC11/ROP1, is involved in the growth responses to the root-colonizing endophytic fungus P.indica.
Species
Arabidopsis thaliana
Sequence
MRDRMERLVVLPFSIGCISVSSVAVLSPLSKPHHHHSRQVIREQEEEDNMKNVFKFLAVSKPEISIGINRIFKSFKTISQLFADKDEEKEEVETSGMEIGVPTNVKHVSHIGWESGLTAATGPGKGWEDLIPPELLAAAASKKEINPHLHPTL
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service