Functions as downstream effector of Rho-related GTP binding proteins of the Rho of Plants (ROPs) family. Participates in the propagation of ROP GTPase signals in specific cellular responses. Functions as downstream effector of ARAC11/ROP1 to activate calcium signaling that leads to F-actin disassembly associated with exocytosis in the tip of the growing pollen tube. Counteracts the ARAC11/ROP1-RIC4 pathway, which promotes apical F-actin assembly associated with vesicle accumulation, to control actin dynamics and pollen tube apical growth.

220 amino acids

MATVKGLLKGLRYITQIFDEEKDKDMQIGFPTDVKHVAHIGSDGPATNVPSWMGDFKPQENENGQVVSRADANNNQIGEGVGLQELLPPTDKPKHKKTRRKSETVSQNGSPPRRNSSASASDMQPKNTRRHHRSRHGSIDSSNDPSVRRRRVVSVTTNDMEGSYPLSDSSTHSRKSTSRHRKPKGSGGGELSMKKTKGKTENPIVESVDTCNDNNISDKE

24.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make RIC3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here