About Products Protein Database Contact

Protein expression services for CSN9 | COP9 signalosome complex subunit 9

Description
Component of the COP9 signalosome (CSN) complex that acts as a regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunit of SCF-type E3 ubiquitin-protein ligase complexes. The complex is involved in the regulation of the mating pheromone response (By similarity).
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Length
163 amino acids
Sequence
MIRQEVLHAVLDPKAVHFKQFWLSSVDRDESELLEVLCFGNYGDLNAIQSCEEWKDAIESKLRTLTLLGLCEVPSELEYDQAMASCCIPDDVILEQRMVELQAQVHFQLDSVGRRIKVLRCLGARDIYNGERPLLLLRDAARSRESTLAGLRQWKQKLQYQLR
Mass
18.8 kDa
Simulated SDS-PAGE
Western blot of CSN9 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make CSN9 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here