Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of E3 ligase complexes, leading to modify the Ubl ligase activity (By similarity).

Belongs to the CSN8 family.

195 amino acids

MKLSESVMAQNSVSFQKLQEQCEEQELEAPGGIASPQVYNQLLALYLLHNDLNNARYLWKRIPSAIKSSHSELGGIWEVGQKIWQRDFPGIYTSISAYQWSENIQQIMEAVRDATQQRAFGLVSQAYTSISADDFAAFVGLPVEEAVKGVLEQGWQADSATGMVMPKKPDSAPLSLIPNEQQLARLTDYVAFLEN

21.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make csn8 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here