Description
Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of E3 ligase complexes, leading to modify the Ubl ligase activity (By similarity).
Family
Belongs to the CSN8 family.
Sequence
MKLSESVMAQNSVSFQKLQEQCEEQELEAPGGIASPQVYNQLLALYLLHNDLNNARYLWKRIPSAIKSSHSELGGIWEVGQKIWQRDFPGIYTSISAYQWSENIQQIMEAVRDATQQRAFGLVSQAYTSISADDFAAFVGLPVEEAVKGVLEQGWQADSATGMVMPKKPDSAPLSLIPNEQQLARLTDYVAFLEN
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service