Component of the COP9 signalosome (CSN) complex that acts as an regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunit of SCF-type E3 ubiquitin-protein ligase complexes.

Belongs to the CSN7/EIF3M family. CSN7 subfamily.

205 amino acids

MEEKISQAIDDPNVFCFQELWIECQEVQKSQPIDSAVLRTLEIFCRGDIRDASSEWNELRFKKLRLLTLIDLANRHVGSSVSFETILVHLQLDRLPPSDPTFTVEYYIMQAMMNQILVGKINAKTQTLHVSWALERFLDSKRIDEMKYSLDRFIERCSNILFQLDAGTPSVSKSFKRASRMSSSDGIDYMVFDKRPRPDDTDFDL

23.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make csn71 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here