Description
Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. The CSN complex plays an essential role in embryogenesis and oogenesis and is required to regulate microtubule stability in the early embryo. Mediates mei-3/katanin targeting for degradation at the meiosis to mitosis transition via deneddylation of cul-3.
Family
Belongs to the peptidase M67A family. CSN6 subfamily.
Species
Caenorhabditis elegans
Sequence
MALNAPSGSCSSKVLLHPLVIMQMSEHYSRTKVQQGPTVKKVFGAILGRQNGRQVEAINSFVLKMETEEMAEPVTFSTEHLLQRADQYLEVFPELQVIGLYCAGEDDNLTPEEKPLLSKLTNAVRNSEKAGQIDATLFLKLNSITAGTTRKLPLFAFEADVTDQEKHKPIEWILVSEESERVGVNHIAKLSTKHGKDGKSVGKKHAEAQDAAMSMLQNRVDLIVAYLEKVQDGTLQPNFEILKEANLLAQKLKTIDRYAAEFTDSFEKEEKTMTVFSLMPRLTTLLGNMQNVWNKLSAQRADLLADDGFHGKSTSRWAHPVRFKSQHLGRPQQADDDDYFDDEDLENDMSGPRRKIHAADSPAGSRRRRVPPRAMNFLGRNSGMQAATDEMELSGQEENMGSNYIPDVPRPSATAHNESDESSQAS
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service