Description
Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of E3 ligasew complexes, leading to modify the Ubl ligase activity. In the complex, it probably acts as the catalytic center that mediates the cleavage of Nedd8 from cullins. Csn5 is essential for growth or survival.
Family
Belongs to the peptidase M67A family. CSN5 subfamily.
Species
Dictyostelium discoideum
Sequence
MSKNGAADALKTFELENNIQTIDHDQLFKYDPQQYQQFLQSKPWSKDPHYFKHVKISAIALLKMVMHARSGGKLEVMGMLMGKVENNTMIIMDSFALPVEGTETRVNAQVEAYEYMVEYLELIKQTGRLENALGWYHSHPGYGCWLSGIDVGTQSVNQQYSEPWLGIVIDPTRTVSAGKVEIGAFRTYPQGYKPPNEGPSEYQSIPLSKIEDFGVHCKQYYSLEITYFKSSLDQQLLDKLWNKYWVNTLSSSPIFSNRDYITGQINDLSEKLEQAETQLSHSRSSILDKKKEESLLSKVSKDSSKVTIEQVQGIMSQVFKNSIFNECQTTKQ
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service