Involved in biosynthesis of legionaminic acid (5,7-diamino-3,5,7,9-tetradeoxy-D-glycero-D-galacto-non-2-ulosonic acid)(Leg), a sialic acid-like derivative that is incorporated into virulence-associated cell surface glycoconjugates such as lipopolysaccharide (LPS) which could be a key determinant in the ability of L.pneumophila to inhibit the fusion of phagosomes with lysosomes. LPS contains a majority alpha2,4-linked homopolymer of legionaminic acid. Catalyzes the conversion of N,N'-diacetyllegionaminic acid (Leg5Ac7Ac) and CTP into CMP-N,N'-diacetyllegionaminic acid (CMP-Leg5Ac7Ac).

Belongs to the CMP-NeuNAc synthase family.

232 amino acids

MRILAVIPARAGSKRLPGKNTRLLAGKPLIAHTIVAALQSSCCEEIVVSTDSKQIADVAVQYGASVPWLRSEDLATDTSDVIHTVIDLLFKFQQMDVFFDSVLLLQPTSPFRKPETIRHAVEIHKVTGKSVVSVSPISLKPSWCRSIDSQGNLVKPELFQDLEIYCNENPIYKLNGSIYIATAKQIIENKSFYSEPTKPLLLNSISESIDIDTPIDWALTEKLMELNQEALV

25.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make neuA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here