Protein expression services for mis19 | CENP-A recruiting complex protein mis19
Description
Component of the CENP-A recruiting complex that ensures the integrity of mitotic spindles through maintenance of kinetochore factors mis6/CENP-I and cnp1/CENP-A (PubMed:24774534, PubMed:24789708, PubMed:25375240). Links mis16 and mis18 to recruit CENP-A through interacting with non-sense-mediated mRNA decay (NMD) factors and the SWI/SNF complex (PubMed:24774534). Links also mis18 with the CCAN/mis6/ctf19 complex to promote CENP-A assembly (PubMed:24789708).
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Length
112 amino acids
Sequence
MDLMPLEKARAIEIAFDNVFHNTKIPDNLQQFDAILKRLERRRFIPTENQKPRVYETELLVLRFREFGVKDNHNHPINLHSLRSKSLIRAQGKKLDLHNRVFLRRNVRAVKM
Mass
13.4 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make mis19 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here