Catalyzes the formation of CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol (CDP-archaeol) from 2,3-bis-(O-geranylgeranyl)-sn-glycerol 1-phosphate (DGGGP) and CTP. This reaction is the third ether-bond-formation step in the biosynthesis of archaeal membrane lipids.

Belongs to the CDP-archaeol synthase family.

168 amino acids

MAQLLTPLESILAIIPALAANGAPVLLKYHGTPIDGGKRFLDGRPVLGPGKTWEGLATGILYGSVIALLAASATCNPKLYAAGVFASIGAMLGDMLGAFIKRRLGLERGAPAPLLDQLDFYSGALLALYAAGYVVHPAVALTFTPIVIALHRLTNMAANRLRLKPVPW

17.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make carS using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here