Probable chaperone protein for the phospholipid-transporting ATPase tat-1. Regulates cell membrane structure and function. Plays a role in maintaining the membrane phosphatidylserine asymmetry and the formation of the tubular membrane structure. Involved in membrane trafficking and is specifically involved in the recycling and degradation of endocytic cargo and this is likely with the phospholipid-transporting ATPase tat-1.

Belongs to the CDC50/LEM3 family.

348 amino acids

MPPRDAVPTSTQVSGIGADGVQTEKVLKNRPKASALRQQKLPAWQPILTATTVIPTVFVIGAIFLPIGVFLFIASDAVSEFTVEYTNCLSPCQLQINLPNAFDGDVFLYYNLENYYQNHRRYVKSRNDQQYLGDLTNVKDCAPFDIDPATKKPIAPCGAIANSIFNDTFTLAHRADTGIVTMVPVTTQGVIWNVDKDRKFKNPPLNDGNLCDAFNNTTKPPNWSKNPCEVGGFENVDFIVWMRTAALPYFKKLWRIVDRTTNPLFSNGLPQGTYILTVENNYPVQSFGGKKEFVISTTSWAGGKNSFLGIAYLVVGSLAIVLGVVFIVIHMKFGHSMNELSNVSEIHH

38.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make chat-1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here