Release of soluble CD40L from platelets is partially regulated by GP IIb/IIIa, actin polymerization, and a matrix metalloproteinases (MMP) inhibitor-sensitive pathway.

Belongs to the tumor necrosis factor family.

272 amino acids

MNEAYSPAAPRPMGSTSPSTMKMFMCFLSVFMVVQTIGTVLFCLYLHMKMDKMEEVLSLNEDYIFLRKVQKCQTGEDQKSTLLDCEKVLKGFQDLQCKDRTASEELPKFEMHRGHEHPHLKSRNETSVAEEKRQPIATHLAGVKSNTTVRVLKWMTTSYAPTSSLISYHEGKLKVEKAGLYYIYSQVSFCTKAAASAPFTLYIYLYLPMEEDRLLMKGLDTHSTSTALCELQSIREGGVFELRQGDMVFVNVTDSTAVNVNPGNTYFGMFKL

30.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make CD40LG using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here