Description
Has 3'-5' poly(A) exoribonuclease activity for synthetic poly(A) RNA substrate. Catalytic component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. During miRNA-mediated repression the complex seems also to act as translational repressor during translational initiation. Additional complex functions may be a consequence of its influence on mRNA expression.
Family
Belongs to the CAF1 family.
Species
Xenopus tropicalis
Sequence
MPAATVDLSQRICEVWACNLDDQMKRIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFVNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTSSGIQFKKHEEEGIETQYFAELFMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEVELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELKRIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service