Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4 (By similarity).

Belongs to the intercrine beta (chemokine CC) family.

151 amino acids

MRPWLLACLVACFVGAWAPAIHAQGAFEDCCLAYHSHIKWRLLRRAHSYQRQDVSGSCNLPAVIFFFPQKDKMVCGKPGAKWVQFGMKILDNRNKKDSKPHHSGRRFFQGPQSGVRKLSSGTSRPLLLKFSGPTRSSKRKASLLTTAIPGP

16.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make CCL25 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here