Chemotactic for resting T-lymphocytes, and eosinophils. Has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. Binds to CCR3 (By similarity).

Belongs to the intercrine beta (chemokine CC) family.

119 amino acids

MAGLATFVVSLLLVTLCAHCIDPAGSVSIPSSCCMFFISKKVPENRVVTYQLLNGSVCPKAGVVFTTKKNQKFCGDPQLHWVQKLMKNIEARRKKVSPGVRAMSTKALVQRYPANSTSI

13 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make CCL24 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here