About Products Protein Database Contact

Protein expression services for CCL2 | C-C motif chemokine 2

Description
Acts as a ligand for C-C chemokine receptor CCR2 (By similarity). Signals through binding and activation of CCR2 and induces a strong chemotactic response and mobilization of intracellular calcium ions (By similarity). Exhibits a chemotactic activity for monocytes and basophils but not neutrophils or eosinophils (By similarity). Plays an important role in mediating peripheral nerve injury-induced neuropathic pain (By similarity). Increases NMDA-mediated synaptic transmission in both dopamine D1 and D2 receptor-containing neurons, which may be caused by MAPK/ERK-dependent phosphorylation of GRIN2B/NMDAR2B (By similarity).
Family
Belongs to the intercrine beta (chemokine CC) family.
Species
Cavia porcellus
Length
120 amino acids
Sequence
MQRSSVLLCLLVIEATFCSLLMAQPDGVNTPTCCYTFNKQIPLKRVKGYERITSSRCPQEAVIFRTLKNKEVCADPTQKWVQDYIAKLDQRTQQKQNSTAPQTSKPLNIRFTTQDPKNRS
Mass
13.7 kDa
Simulated SDS-PAGE
Western blot of CCL2 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make CCL2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here