Functions as an activator subunit for the CBK1 protein kinase. Part of the regulation of ACE2 activity and cellular morphogenesis (RAM) signaling network. Required for coordinating polarized cell growth during interphase with the onset of mitosis. Required for mother/daughter cell separation after cytokinesis. Also has a role in the prevention of nuclear export of ACE2 from the daughter cell nucleus after mitotic exit. It coordinates ACE2-dependent transcription with mitotic exit network activation.

Belongs to the MOB1/phocein family.

287 amino acids

MSFFNFKAFGRNSKKNKNQPLNVAQPPAMNTIYSSPHSSNSRLSLRNKHHSPKRHSQTSFPAQKSTPQSQQLTSTTPQSQQQEASERSESQQIMFLSEPFVRTALVKGSFKTIVQLPKYVDLGEWIALNVFEFFTNLNQFYGVVAEYVTPDAYPTMNAGPHTDYLWLDANNRQVSLPASQYIDLALTWINNKVNDKNLFPTKNGLPFPQQFSRDVQRIMVQMFRIFAHIYHHHFDKIVHLSLEAHWNSFFSHFISFAKEFKIIDRKEMAPLLPLIESFEKQGKIIYN

33.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make MOB2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here