Functions as an activator subunit for the CBK1 protein kinase. Part of the regulation of ACE2 activity and cellular morphogenesis (RAM) signaling network. The RAM network is critically required for hyphal growth as well as normal vegetative growth, and for polarization of lipid rafts and the actin cytoskeleton. It play an essential role in biofilm formation. The RAM network plays also a role in serum- and antifungal azoles-induced activation of ergosterol biosynthesis genes, especially those involved in the late steps of ergosterol biosynthesis.

Belongs to the MOB1/phocein family.

313 amino acids

MSFLNTIRGLGRGSKKNKKDLEPSNNAIYSHSNLSGNGLRRTQSPTKFSPSKLSSKGAQGSAAYTSSPTKRSRTGQSLQHQDSQSSLQYQQQSGSVSPSKRSSIQTTKSTTVNADPPLFLCEPYVKTALVKGSFKTIVQLPKYVDYCEWLALNIFELFNHLNRFYGVIQEYATPEAYPTMNAGPNTNYLWVNSSGQAVNLPACQYIEYVITWVTNKLNDQSVFPTKNGGAFPPNFIKDCKNISRQMFRIFAHIYHNHFDKIIHLSLEAHWNSFFAHFISFVKEFNLIDRTEMEPLLPLIENFEQQGKITQASK

35.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make MOB2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here