Responsible for the transport of dicarboxylates such as succinate, fumarate, and malate from the periplasm across the membrane. This transport system plays an important role in the energy supply of rhizobium-legume symbionts (By similarity).

Belongs to the dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family.

442 amino acids

MHIADQSGAAAAQRKPLYAQLYVQVLVAITVGILLGHYYPSIGESMKPLGDAFIKLVKMIIAPVIFLTVATGIAGMSDLQKVGRVAGKAMLYFLTFSTLALIIGLVVANVVQPGAGFNIDPATLDASTVNTYAAKAHDQSVTGFLMNIIPGTIVGAFADGDILQVLFFSVLFGIALALVGDKGAPVLNFLQALMAPMFKLVSVLMKAAPIGAFGAMAFTIGKYGIGSVINLAMLVGTFYATSLLFVFVVLGAVCRYNGFSILSLLRYIKEELLLVLGTSSSEAALPSLMEKMEKAGAKRSVVGLVIPTGYSFNLDGTNIYMTLAALFIAQATNIHLSMGDQILLLLVAMLSSKGAAGITGAGFITLAATLSVVPSVPVAGMALILGVDRFMSECRALTNFIGNAVATLVVARWEGELDEAKLARALAGTADDSLPADIVPAE

46.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make dctA2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here