Antimicrobial peptide. Active against the Gram-positive bacteria S.aureus FDA209P (MIC=9.8 ug/ml) and B.subtilis ATCC 6633 (MIC>64 ug/ml), and the Gram-negative bacteria E.coli O111 (MIC=19.6 ug/ml) and E.coli ATCC 25922 (MIC=9.8 ug/ml). Not active against the fungus C.albicans.

Belongs to the frog skin active peptide (FSAP) family. Brevinin subfamily.

72 amino acids

MFTMKKSLLLLFFLGMISLSLCEQERGADEDEGEVEEQIKRSIWEGIKNAGKGFLVSILDKVRCKVAGGCNP

8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make br2GHc using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here