Converts 2-oxo acids to branched-chain amino acids. Shows activity with L-Leu, L-Ile and L-Val as amino donors and 2-oxoglutarate as an amino acceptor, but no activity for D-isomers of Leu, Ile, Val, Asp, Glu or Ala.

Belongs to the class-IV pyridoxal-phosphate-dependent aminotransferase family.

388 amino acids

MIKTITSLRKTLVLPLHLHIRTLQTFAKYNAQAASALREERKKPLYQNGDDVYADLDWDNLGFGLNPADYMYVMKCSKDGEFTQGELSPYGNIQLSPSAGVLNYGQAIYEGTKAYRKENGKLLLFRPDHNAIRMKLGAERMLMPSPSVDQFVNAVKQTALANKRWVPPAGKGTLYIRPLLMGSGPILGLGPAPEYTFIVYASPVGNYFKEGMAALNLYVEEEYVRAAPGGAGGVKSITNYAPVLKALSRAKSRGFSDVLYLDSVKKKYLEEASSCNVFVVKGRTISTPATNGTILEGITRKSVMEIASDQGYQVVEKAVHVDEVMDADEVFCTGTAVVVAPVGTITYQEKRVEYKTGDESVCQKLRSVLVGIQTGLIEDNKGWVTDIN

42.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Have you tried producing BCAT2 in a cell-free protein expression systems? We have solved cell-free protein expression scale-up and purification challenges so that you can obtain up to low-milligram quantities of proteins in hours.

Order Here