Bombinin H-BO1: Has no antimicrobial activity at concentrations up to 161 uM. Has moderate hemolytic activity towards human erythrocytes at a concentration of 40.3 uM.

Belongs to the bombinin family.

132 amino acids

MNFKYIIAVSFLIASAYARSEEYDIQSLSQRDVLEEESLRKIRGIGSAILSAGKSIIKGLAKGLAEHFGKRTAEDHEVMKRLEAAMRDLDSLDYPEEASERETRGFNQEEKEKRIIGPVLGLVGKALGGLLG

14.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make BLP8-BH9 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here