Exhibits the same spectroscopical features and blue-light induced photochemistry as plants phototropins, with the reversible formation of a blue-shifted photoproduct, assigned to an FMN-cysteine thiol adduct. Positive regulator in the activation of the general stress transcription factor sigma-B (By similarity).

253 amino acids

MSAYPKFDVILKALNLSSVGVIITDPEQKNNPIIFVNTGFENITGYTKEEAIGSNCHFLQGDDTDKEEVAKIRHAINEKSTANVLLKNYRKNGTSFMNELTIEPIYDDNDHLYFVGIQKDVTTEHNYQLELEKSLWEIEKLSTPIVPIKENICVLPLIGSLTHDRFQHMSDYVSEYMDNGKEDYLIMDLSGLADFNEDAVMNLVKFHGFMKLTGVELIITGISPKFAMTLMRYQENLSSLTTYSTIKEALQFY

28.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make lin0792 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here