Peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.

Belongs to the glycosyltransferase 51 family.

243 amino acids

MYQWIQRDSDVHQRWIWCRRLLIVSLVSALMSVLQVIVFRFVDPPLSMTMVGRYLEAWSDRQWNFRLHYVWCDLEQIAPSVPISLVAAEDQRFPFHHGFDFDAIKKALGRHSRGGHLRGASTISQQVAKNLFLWSGRSFVRKGLEGWYTFWIELFWPKRRILEIYANIAEFGDGVYGVQAAARRYLGKGAADLDESDAAQLAAVLPSPRHYNIQHPGPYIRWRSSWIQRQAKQLGGSAYLDMH

28.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mtgA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here