Protein expression services for Pldn | Biogenesis of lysosome-related organelles complex 1 subunit 6
Description
Component of the biogenesis of lysosome-related organelles complex-1 (BLOC-1) involved in pigment granule biogenesis and membrane trafficking in synapses (PubMed:20015953, PubMed:28317021). In response to high synaptic activity at neuromuscular junctions, plays a key role in promoting efficient synaptic vesicle recycling and re-formation through early endosomes (PubMed:28317021).
Family
Belongs to the BLOC1S6 family.
Species
Drosophila melanogaster
Length
167 amino acids
Sequence
MLKSSNINSVLNELPNDPARDSTAQSSHNGKPKQDAETCCSSQDNEVMASLAALQLSAGVLQIAEPPLNHVRTQLRELIGRQNKTYIDLSKEKYKLDCSEVARLNDMMSDVKRYKDKLTKIKKEMQGVYQRTKELKKRAANVAACKQRDYQRKLERLQHEESLIGSQ
Mass
19 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Pldn using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here