Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze sulfonation of hydroxysteroids and xenobiotics.

Belongs to the sulfotransferase 1 family.

285 amino acids

MMSDYNWFEGIPFPAISYQREILEDIRNKFVVKEEDLLILTYPKSGTNWLNEIVCLIQTKGDPKWIQTVPIWDRSPWIETEIGYSAIINKEGPRLITSHLPIHLFSKSFFSSKAKAIYLMRNPRDILVSGYFFWGNTNLVKNPGSLGTYFEWFLQGNVLFGSWFEHVRGWLSMREWDNFLVLYYEDMKKDTKGTIKKICDFLGKNLGPDELDLVLKYSSFQAMKENNMSNYSLIKEDRVTNGLKLMRKGTTGDWKNHFTVAQAEAFDKVFQEKMAGFPPGMFPWE

33.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Sult2a2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here