Also displays a weak uracil phosphoribosyltransferase activity which is not physiologically significant.

Belongs to the purine/pyrimidine phosphoribosyltransferase family. PyrR subfamily.

174 amino acids

MQKEVVDSMAMKRALTRITYEIIEQNKGIKNVVLVGVKTRGVYIAQRIAAQLQQLEGTAIPVGELDITAFRDDQPLDQARLSTDYQLTFSVADKRVILVDDVLFTGRTIRAALDALMGGGRPQSIALAVLVDRGHRELPIRADFIGRNIPTARQERIKVTVNEIDGHDGIEIIN

19.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make pyrR2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here