Catalyzes the isomerization of both glucose 6-phosphate and epimeric mannose 6-phosphate at a similar catalytic efficiency.

Belongs to the PGI/PMI family.

304 amino acids

MQFSEELLTLKDQVRFDKSFKVGKYDKIVIAGMGGSGIAGRIFSEIYDEKPVFLVDDYDIPSFVDDKTEFIAISYSGNTEETISASEEAAKKHANVHAITSGGSLSKMGFDTIIIPSGLQPRSSIGYLLMPLVNTFIKPKIGDVDEAYRLLSETDKDNEEEKSIASEIYNGEHIPVIYGSRPFRAIAYRWKTQFNENAKVLAYSNYFSELNHNDTMPLKDTYRKDEFYFLVFRSDDSRFSKRITVTEKITGNSFRMVDVRGSSLLAKLFYLIHFGDYLTYHLAELRGVDPQDVSLIEKLKKEIA

34.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make TV1464 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here