Converts a single cis double bond at position 12 of linoleate incorporated into phosphatidylcholine into conjugated 11-trans and 13-cis double bonds (PubMed:12354116, PubMed:12464604, PubMed:25000918). Produces punicic acid (18:3(9Z,11E,13Z)) from linoleic acid and conjugated octadecatetraenoic fatty acid from gamma-linolenic acid (PubMed:12354116, PubMed:25000918). No activity with cis- and trans-vaccenic acid, alpha-linolenic acid or homo-gamma-linolenic acid (PubMed:12354116). 16:2(9Z,12Z), 18:3(9Z,12Z,15Z) and 18:2(9Z,12Z) are substrates for the conjugase to form trans-Delta(11) and cis-Delta(13) double bonds (PubMed:12464604). No activity on the cis-Delta(9) double bonds of oleic and palmitoleic acids (PubMed:12464604).

Belongs to the fatty acid desaturase type 1 family.

395 amino acids

MGADGTMSPVLTKRRPDQEINKLDIKPNHEVDIARRAPHSKPPFTLSDLRSAIPPHCFHRSLLMSSSYLIRDFALAFLFYHSAVTYIPLLPKPLACMAWPVYWFLQGSNMLGIWVIAHECGHQAFSNYGWVNDAVGFFLHTSLLVPYFPFKYSHRRHHSNTNSVEHDEVFVPRHKDGVQWYYRFFNNTPGRVLTLTLTLLVGWPSYLAFNASGRPYDGFASHYNPNAQIFNLRERFWVHVSNIGILAIYYILYRLATTKGLPWLLSIYGVPVLILNAFVVLITFLQHSHPALPHYNSDEWDWLRGALATVDRDYGFLNEVFHDITDTHVIHHLFPTMPHYNAKEATVSIRPILKDYYKFDRTPIWRALWREAKECLYVEADGTGSKGVLWFKSKF

45.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FADX using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here