In the first step of betaine reductase, the substrate is bound to component PB via a Schiff base intermediate. Then the PB-activated substrate is nucleophilically attacked by the selenol anion of component PA to transform it to a carboxymethylated selenoether and the respective amine. By action of component PC, acetyl phosphate is formed, leaving component PA in its oxidized state. Finally component PA becomes reduced by the thioredoxin system to start a new catalytic cycle of reductive deamination.

Belongs to the GrdB/GrdF/GrdH family.

437 amino acids

MKKAILYLNQFFGQVGGEDKADYEPEIINGQVGAAMMLNGVLEGAEVTHTIICGDNFMGTYKDEAVSRIMGFLEDKEFDIFLAGPAFQAGRYGVACGEICKVVKEKYNVPVVTSMHVENPGVQMFKKDMYVMIGGNNAGRMRQDMSAMAKVANKIIAGEKIGPADEEGFFPRGKRHQHWREDGKPASERVVDMLLKKLSGEEFQTELPIPKSDRVEIAAPIKDLSKATIAVVTTGGIVPVDNPDRIQSASATRWGMYDVTGLERLEGGVYKTIHAGFDPAAADADPNVIVPLDALRAYEKEGKIGKVHEYFYSTVGTGTTEAEAARMAKEIVVKLKQGGVDGVIMTSTUGTCTRCGATMVKEIERAGFPIVQMCNLIPVASTVGANKIVPTISIPYPLGDPSTSKEQQWKLRYHRVGTALDALTVDVQEQTIFKVKI

47.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make grdH using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here