Hexoaminidase complex may contribute to amoebic pathogenicity and may be involved in the destruction of extracellular matrix components.

Belongs to the glycosyl hydrolase 20 family.

565 amino acids

MIVLLLLISYCFAGNGVNVKNQLLLMPYPTTVNAQFGSNDCVEATSNIKMVLSNNCQNDPNCLSFMTFNFNHTITYPLQRQRNLEDFRVSIFAPIDIEEMKGNVVYSANTVNIELTGNNIEEIYPPLKIGIDESYSLDVTKEGIKISATTVYGARLGLETLIQMLRPYQGKYIIKHIPIMIEDKPRLQWRGLMIDVARNSFSRSAFVKIINAMAAIKANVLHIHLSDAQTFMFESKEYPELSKKGAFFQNKVLTQSFIKQLVQYGAKRGVIVYPEIDTPAHTASWNAGYPGVVADIWDYIVSSSMRYGENVLALNPANEKTFSIIDALMKEMGEVFGNDYVHFGGDEVWTGAWSKAKEYPAILEWMNKKGINTLKELEAYFNKYAQEQIIKNGKTPVCWEEVYQKGSADKKTIIQVWNNVNLLKEAATAGYKVILSAGYYLDMQMPLCSDYVADSCTNPNHMWVWTNRDMYRNDPIKELDYATKQNVLGGEACSWDESVDEQNFFDRVFQRFSAVAERFWSSEDITDPESHEVRANYVRCLGLRRNFLKGTGPLYHSYCQLPEDI

64.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make HEXB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here