Protein expression services for GALT31A | Beta-1,6-galactosyltransferase GALT31A
Description
Beta-galactosyltransferase involved in elongation of beta-1,6-linked galactan side chains on arabinogalactan proteins. Required for the progression of embryogenesis beyond the globular stage (PubMed:23837821). Beta-galactosyltransferase involved in the biosynthesis of type II arabinogalactan. Transfers galactose from UDP-galactose to a mixture of various oligosaccharides derived from arabinogalactan proteins. Forms a complex with GALT29A that can work cooperatively to enhance the activities of adding galactose residues at O6 positions to beta-1,6-linked galactan and beta-1,3-linked galactan (PubMed:24693939).
Family
Belongs to the glycosyltransferase 31 family.
Species
Arabidopsis thaliana
Length
399 amino acids
Sequence
MGMGRYQKSATSGVSARWVFVLCISSFLLGVLVVNRLLASFETVDGIERASPEQNDQSRSLNPLVDCESKEGDILSRVSHTHDVIKTLDKTISSLEVELATARAARSDGRDGSPAVAKTVADQSKIRPRMFFVMGIMTAFSSRKRRDSIRGTWLPKGDELKRLETEKGIIMRFVIGHSSSPGGVLDHTIEAEEEQHKDFFRLNHIEGYHELSSKTQIYFSSAVAKWDADFYIKVDDDVHVNLGMLGSTLARHRSKPRVYIGCMKSGPVLAQKGVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISVNRQLLHKYANEDVSLGSWFIGLDVEHIDDRSLCCGTPLDCEWKGQAGNPCAASFDWSCSGICKSVDRMLEVHQRCGEGDGAIWHSSF
Mass
44.6 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make GALT31A using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here