Catalyzes the synthesis of lactosylceramide (LacCer) via the transfer of galactose from UDP-galactose to glucosylceramide (GlcCer) (By similarity). Required for proper patterning of the dorsoventral axis during embryogenesis through the regulation of BMP signaling (PubMed:16672343). Plays a role in proteoglycan glycosylation that is required for BMP-dependent specification of the dorsoventral axis (PubMed:16672343).

Belongs to the glycosyltransferase 7 family.

381 amino acids

MPTHLRFRRRSFLGLLFLFSLSTSALYFIYSAPGIVNEYLFMVQARGIQIRENVRNMGAQVLEQVVRSAYSINGTDYTYEFNFSETDASPTPFLPEGFTYKPEQVCPEKLPSMKGRLKVNMSEIALDEVEKLLKLNDPGLSVGGHWKPHDCRPRWKVAILVPFRNRHEHLPILFRHLIPALQRQRLQFGFYVIEQAGNEPFNRAMLFNVGFKEAMKDLNWDCVIFHDVDHILENDRNYYGCGEMPRHFAVKLNKYSYMLPYEEFFGGVSGLTVKQFKRINGFPNAFWGWGGEDDDLWNRVQFAGYKVSRPHGELGRYMSIPHHHRGEVQFLGRYKLLRRSKERQSLDGLNNLNYSPLVSRRSLYTNVSVTLSRDLAPVADY

44.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make b4galt5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here