Catalyzes the hydrolysis of beta-1,3-xylan into oligosaccharides, mainly xylotriose and xylobiose with smaller amounts of xylotetraose, xylose, xylopentaose and xylohexaose. Does not hydrolyze xylobiose, p-nitrophenyl-beta-xyloside, beta-1,4-xylan, carboxymethylcellulose, curdlan, glucomannan or beta-1,4-mannan.

Belongs to the glycosyl hydrolase 26 family.

469 amino acids

MKKLAKMISIATLGACAFSAHALDGKLVPNEGVLVSVGQDVDSVNDYSSAMSTTPAGVTNYVGIVNLDGLASNADAGAGRNNVVELANLYPTSALIVGVSMNGQIQNVAQGQYNANIDTLIQTLGELDRPVYLRWAYEVDGPWNGHNTEDLKQSFRNVYQRIRELGYGDNISMIWQVASYCPTAPGQLSSWWPGDDVVDWVGLSYFAPQDCNWDRVNEAAQWARSHNKPLFINESSPQRYQLADRTYSSDPAKGTNRQSKTEQQIWSEWFAPYFQFMEDNKDILKGFTYINADWDSQWRWAAPYNEGYWGDSRVQVLPYIKQQWQDTLENPKFINHSSDLFAKLGYVADGGDNGGDNGGDNGGDNGGDNGGDNGGTEPPENCQDDFNFNYVSDQEIEVYHVDKGWSAGWNYVCLNDYCLPGNKSNGAFRKTFNAVLGQDYKLTFKVEDRYGQGQQILDRNITFTTQVCN

52.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make txyA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here