Protein expression services for GCNT1 | Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase
Description
Glycosyltransferase that catalyzes the transfer of an N-acetylglucosamine moiety onto mucin-type core 1 O-glycan to form the branched mucin-type core 2 O-glycan. Mucin-type core 2 O-glycans play an important role in leukocyte extravasation as they serve as scaffolds for the display of the selectin ligand sialyl Lewis X by leukocytes.
Family
Belongs to the glycosyltransferase 14 family.
Species
Bos taurus
Length
427 amino acids
Sequence
MLRKLWRRKLFSFPTKYYFLFLAFSVVTFTVLRIHQKTEFVNFGHLELFEENPSSNINCTKILQGDVDEIQKVKLESLTVKFKKRARWTNYDYINMTGDCASFIKKRKYITEPLSKEEAGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDAKSEKSFLAAAVGIASCFSNVFVASQLESVVYASWSRVQADLNCMQDLYQMNAGWKYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETEKMPSHKKERWKKHYEVVNGKLTNMGTDKIHPPLETPLFSGSAHFVVSREYVEYVLQNQNIQKFMEWAKDTYSPDEYLWATIQRIPEVPGSLSLSYKYDTSDMQAIARFVKWQYFEGDVSKGAPYPPCSVHVRSVCVFGAGDLNWLLHVHHLFANKFDTDIDLFAIQCLDEHLRHKALETLKP
Mass
49.7 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make GCNT1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here