Description
Acts as negative regulator of seedling photomorphogenesis and light-regulated inhibition of hypocotyl elongation (PubMed:17605755, PubMed:18540109, PubMed:21685177). BBX24/STO and BBX25/STH function as transcriptional corepressors of HY5 activity, leading to the down-regulation of BBX22 expression. BBX24/STO acts additively with BBX25/STH during de-etiolation and the hypocotyl shade avoidance response (PubMed:23624715). Functions as negative regulator of photomorphogenic UV-B responses by interacting with both COP1 and HY5 (PubMed:22410790). May act as a transcription factor in the salt-stress response (PubMed:12909688).
Species
Arabidopsis thaliana
Sequence
MKIQCDVCEKAPATVICCADEAALCPQCDIEIHAANKLASKHQRLHLNSLSTKFPRCDICQEKAAFIFCVEDRALLCRDCDESIHVANSRSANHQRFLATGIKVALTSTICSKEIEKNQPEPSNNQQKANQIPAKSTSQQQQQPSSATPLPWAVDDFFHFSDIESTDKKGQLDLGAGELDWFSDMGFFGDQINDKALPAAEVPELSVSHLGHVHSYKPMKSNVSHKKPRFETRYDDDDEEHFIVPDLG
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service