Acts as negative regulator of seedling photomorphogenesis (PubMed:18540109). Acts as a negative regulator of blue light-mediated inhibition of hypocotyl elongation through increase of bioactive gibberellin levels (PubMed:20872270). Acts as a repressor of thermotolerance by modulating expression of a set of heat shock-responsive genes (PubMed:23238922).

172 amino acids

MRILCDACESAAAIVFCAADEAALCCSCDEKVHKCNKLASRHLRVGLADPSNAPSCDICENAPAFFYCEIDGSSLCLQCDMVVHVGGKRTHRRFLLLRQRIEFPGDKPNHADQLGLRCQKASSGRGQESNGNGDHDHNMIDLNSNPQRVHEPGSHNQEEGIDVNNANNHEHE

18.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make BBX18 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here