Forms a concentration gradient along the pollen tube growth path, with a lower level in the stigma papilla cell wall and a higher level in the transmitting tract extracellular matix of the style.

129 amino acids

MAKGRGSASWSARAIVTLMAVSVLLLQADYVQAATYTVGDSGIWTFNAVGWPKGKHFRAGDVLVFNYNPRMHNVVKVDSGSYNNCKTPTGAKPYTSGKDRITLSKGQNFFICNFPNHCESDMKIAVTAV

14 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ARPN using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here