About Products Protein Database Contact

Protein expression services for KCTD11 | BTB/POZ domain-containing protein KCTD11

Description
Plays a role as a marker and a regulator of neuronal differentiation; Up-regulated by a variety of neurogenic signals, such as retinoic acid, epidermal growth factor/EGF and NGFB/nerve growth factor. Induces apoptosis, growth arrest and the expression of cyclin-dependent kinase inhibitor CDKN1B. Plays a role as a tumor repressor and inhibits cell growth and tumorigenicity of medulloblastoma (MDB). Acts as probable substrate-specific adapter for a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex towards HDAC1. Functions as antagonist of the Hedgehog pathway on cell proliferation and differentiation by affecting the nuclear transfer of transcription factor GLI1, thus maintaining cerebellar granule cells in undifferentiated state, this effect probably occurs via HDAC1 down-regulation, keeping GLI1 acetylated and inactive (By similarity).
Species
Bos taurus
Length
232 amino acids
Sequence
MLGAMFRAGTPMTPNLNPEGGGHYFIDRDGKAFRHILNFLRLGRLDLPLGYGETALLRAEADFYQIRPLLDALRELEASRGTPAPTAALLHADVDSSPRLVHFSARRGPHHYELSSVQVDTFRANLFCTDPECLGALRARFGVTNEDRAEGGPHFRLEWAPRPAELPEVEYRRLGLQPLWTGAPGEPRDVVGTPSFLEEVLRVALEHGFRLDSVFPDPEDLLNSRSLRFVRH
Mass
26 kDa
Simulated SDS-PAGE
Western blot of KCTD11 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make KCTD11 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here