E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt) and autophagy (By similarity). Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production (By similarity). Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of ATG8 (By similarity). The ATG12-ATG5 conjugate plays a role of an E3 and promotes the transfer of ATG8 from ATG3 to phosphatidylethanolamine (PE) (By similarity). This step is required for the membrane association of ATG8 (By similarity). The formation of the ATG8-phosphatidylethanolamine conjugate is essential for autophagy and for the cytoplasm to vacuole transport (Cvt) (By similarity). The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy (By similarity).

Belongs to the ATG3 family.

346 amino acids

MNFLRSTAATLLDKYTPVSHTSTFRNTGQITPEEFVAAGDYLTFKFPSWSWADADSPSKRLTFLPAGKQFLVTRHVPCHRRLNNDFAGDAGHEEALVEGNKGGDDDDGWLRTGSMTSSQPLRVREVRNIDDAGNVGDREVVDEDDIPDMEDDDDDEAIIRAEGDNSNSGKRTYTLYITYANAYKCPRMYMSGYLANGQPLPPHLMMEDIVGDYKDKTVTLEDFPFFSHSVKMASVHPCRHASVMKTLLDRADAALKLRREKMKAGQGSGSEQGMEGLVDEINKLDVSGAHANAVEAAPGEDAEWEEVPHDVTDQEVAIRVDQYLVVFLKFIASVTPGIEHDFTMGV

38.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ATG3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here