Stabilizes the atg5-atg12 conjugate and mediates the formation of the 350 kDa complex, which is necessary for autophagy. The atg5-atg12/atg16 complex is required for efficient promotion of atg8-conjugation to phosphatidylethanolamine and atg8 localization to the preautophagosomal structure (PAS). Involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. Required for meiotic chromosome segregation.

Belongs to the ATG16 family.

143 amino acids

MELIKKIQDRDAAEKAYYDVIEPYSELLEFSFHKEFVSEEKVTQRTASSDSLNTIASENNDENVINLEEFRQLKRNCDLYQRNLQKLQLLFKQQSQKNTLLEKQLSLQTELNQEKDKRVKILQDELWALQLEVAALERKSPNA

16.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make atg16 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here