Catalyzes the phosphorylation of autoinducer-2 (AI-2) to phospho-AI-2, which subsequently inactivates the transcriptional regulator LsrR and leads to the transcription of the lsr operon. Phosphorylates the ring-open form of (S)-4,5-dihydroxypentane-2,3-dione (DPD), which is the precursor to all AI-2 signaling molecules, at the C5 position.

Belongs to the FGGY kinase family.

530 amino acids

MSQLDTTTPSGDYLMALDAGTGSVRAVIFDLNGNQIAAGQAEWLHLPVPDVPGSMEFDLTTNWQLTCQCIRQALHLAKLPASAIRAVAACSMREGIVLYDRSGTPIWACANVDARASREVSELKELHNNGFELEVYQCSGQTLALSAMPRLLWLAHYRPDIYRQAGTLTMISDWLANMLSGELAVDPSNAGTTGMLDLVTRNWQPNLLEMAGLRADILSPVKETGTLLGHVTAKAAQECGLLAGTPVVMGGGDVQLGCLGLGVVHAGQTAVLGGTFWQQVVNLPQPIIDPNMNTRINPHVIPGMVQAESISFFTGLTMRWFRDAFCAEEKLLAQRLGIDTYSLLEDMAARVPAGAYGVMPIFSDVMRFKSWYHAAPSFINLSLDPEKCNKATLFRALEENAAIVSACNLAQIAEFSGVKASSVVFAGGGAKGKLWSQILADVTGVPVKVPVVKEATALGCAIAAGVGVGLYEALDKTGERLVRWEREYIPNTEHKALYQAAKTNWQAVYTDQLGLVDCGLTTSLWKAPCL

57 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make lsrK using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here