Part of the gene cluster that mediates the biosynthesis of aspergillic acid, a hydroxamic acid-containing pyrazinone with aliphatic side chains that originates from leucine (Leu) and isoleucine (Ile) (PubMed:29674152). Aspergillic acid has antibiotic properties and was shown to be lethal to mice (PubMed:29674152). The first step in the pathway is the production of deoxyaspergillic acid via a condensation between the Ile amine and the Leu carboxylic acid, followed by a reductive release from the protein forming the dipeptide aldehyde NH(2)-Leu-Ile-CHO, which could undergo an intermolecular cyclization resulting in a dihydropyrazinone (PubMed:29674152). As the NRPS asaC lacks a condensation domain, it is improbable that it is responsible for condensation of Leu and Ile (PubMed:29674152). One possibility is that asaC acts on a previously condensed dipeptide and functions as a Leu-Ile reductase to yield deoxyaspergillic acid (PubMed:29674152). After asaC forms deoxyaspergillic acid, the cytochrome P450 asaD oxidizes the pyrazinone to the hydroxamic acid-containing bioactive metabolite aspergillic acid (PubMed:29674152). The hydroxylase/desaturase asaB can then convert aspergillic acid to hydroxyaspergillic acid (PubMed:29674152). Both aspergillic acid and hydroxyaspergillic acid can form complexes with iron producing ferriaspergillin analogs (PubMed:29674152).

83 amino acids

MSPTITRPLIGQLCPLTNVGQIAETFSSEEVSFVETVDPLRHASKGGHHDDDNLPQGTLNNIWRGNPVIAWAALLRIAHKHFR

9.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make asaF using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here