About Products Protein Database Contact

Protein expression services for gatC | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

Description
Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).
Family
Belongs to the GatC family.
Species
Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)
Length
95 amino acids
Sequence
MSLTHQDVARIAKLARINVSEAEIAATADQLNNIFGLIEKMQAVDTAGIEPMAHPQDVSLRLRDDVVTEPNRREAFQAVAPQVEKGLFLVPKVIE
Mass
10.5 kDa
Simulated SDS-PAGE
Western blot of gatC recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make gatC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here