Secreted aspartic endopeptidase that allows assimilation of proteinaceous substrates. The scissile peptide bond is attacked by a nucleophilic water molecule activated by two aspartic residues in the active site. Shows a broad primary substrate specificity. Favors hydrophobic residues at the P1 and P1' positions.

Belongs to the peptidase A1 family.

389 amino acids

MVLINQLGAVLAVCATLTVAAPTKGKARFNVPQVAIPKKMVHHPAVSYARALHKFGMKVPKTVQDAAKGSVPTTPTPSDEQYVTQVTVGEGKLNLDLDTGSGDLQGHNLYKPTSNSKRLNGYSWQISYGDMSSAGGDVFLDTVSIGDVTASSQAVESAKKVSDQFAKDKATDGLMGLSFSVLNTVQPKPQTTFLDTVLSQLEKPLFTCTLKHGEPGSYDFGYIDDAKHSGEITYTQVDNSEGWWGFTADSYSIGGPNTTSFRGDSSGMANGGSISGIADTGTTLMLLSDDVVGEYYGQVQGATNDQQQGGYIFPCDAQLPDFTLSIGGYNAVVPGKFMNYQEIDGSMCFGGLQSSGSSGGPNIFGDVFLKSQFVVWDTQGPRIGFAPQA

41.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make MCYG_00144 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here