About Products Protein Database Contact

Protein expression services for AHR | Aryl hydrocarbon receptor

Description
Ligand-activated transcriptional activator. Binds to the XRE promoter region of genes it activates. Activates the expression of multiple phase I and II xenobiotic chemical metabolizing enzyme genes (such as the CYP1A1 gene). Mediates biochemical and toxic effects of halogenated aromatic hydrocarbons. Involved in cell-cycle regulation. Likely to play an important role in the development and maturation of many tissues. Regulates the circadian clock by inhibiting the basal and circadian expression of the core circadian component PER1. Inhibits PER1 by repressing the CLOCK-ARNTL/BMAL1 heterodimer mediated transcriptional activation of PER1. The heterodimer ARNT:AHR binds to core DNA sequence 5'-TGCGTG-3' within the dioxin response element (DRE) of target gene promoters and activates their transcription.
Species
Delphinapterus leucas
Length
845 amino acids
Sequence
MNSSSASITYASRKRRKPVQKTVKPVPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVVNKLDKLSVLRLSVSYLRAKSFFDVALKSTPADRNGVQDNCRTKFREGLNLQEGEFLLQALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPSQCPDSGQKMDEANGLSQPAVYYNPDQVPPENSSSMERCFVCRLRCLLDNSSGFLAMNFQGRLKYLHGQNKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPTGCDAKGRIVLGYTEAELCMRGSGYQFIHAADMLYCAEYHIRMIKTGESGLIVFRLLTKDNRWTWVQSNARLVYKNGRPDYIIATQRPLTDEEGTEHLRKRNLKLPFMFTTGEAVLYEVTNPFPPIMDPLPIRTKNGAGGKDSATKSTLSKDFLNPSSLLNAMMQQDESIYLYPASSSTPFERNFFSDSQNECSNWQNNVAPMGSDDILKHEQIGQSQEMNPTLSGDHAGLFPDNRNSDLYSIMKHLGIDFEDIKHMQQNEEFFRTDFSGEDDFRDIDLTDEILTYVEDSLNKSALGCSGYHPQQSMALNPSCMVQEHLQLEQQEQRQQHQKHRAVEQQQLCQKMQHMQVNGMFANWSSNQSGPFNCPQPDLQQYDVFSDVPGTSQEFPYKSEIDTMPYAQNFIPCSQSVLPPHSKGTQLDFPIGDFEPAPYPTTSSNLEDFVTCLQVPQSQRHGLNPQSAIVTPQTCYTGAVSMYQCQPEAQHSHVAQMQYNPTVPGPQAFLNKFQNGGVLNETYPAELNSINNTQPTTHLHPSEARPFSDLTSSGFL
Mass
95.4 kDa
Simulated SDS-PAGE
Western blot of AHR recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make AHR using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here