Catalyzes the transfer of a methyl group from AdoMet to arsenite, producing methylated arsenicals. Involved in the conversion of As(III) to a number of methylated products. Reduces the arsenic toxicity in the cell and may contribute to the global arsenic cycling.

Belongs to the methyltransferase superfamily. Arsenite methyltransferase family.

249 amino acids

MDAAEKKEVIKKKYQEIATLGGSCCSGGGCCGDLSAADLSRSLGYSEADVQAVPDANLGLGCGNPTAFAELKPGDIVLDLGSGAGFDSFLAAQRVGSLGKVIGVDMTQEMVKKAQDNARKYGYSNVEFRQGDIEALPLDDRSVDVIISNCVINLAPDKEKVFREAFRVLKPGGRMYVSDMVLLEDLPEDLKNDCDLLAGCVAGALLKEEYLGLLKKAGFSFKILAEDSDVSKRQYEGLPVESLKLKAWV

26.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make arsM using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here