Catalyzes the transfer of a methyl group from AdoMet to arsenite, producing methylated arsenicals. Involved in the conversion of As(III) to dimethylarsenate as the main product in the medium and also produces dimethylarsine and trimethylarsine gases. Reduces the arsenic toxicity in the cell and may contribute to the global arsenic cycling.

Belongs to the methyltransferase superfamily. Arsenite methyltransferase family.

346 amino acids

MHESVQNYYGKVLQNSSDLKTSACCDASSMPAWLKPLLSQVHPEVSARYYGCGLVAPALLDGCQVLDLGSGSGRDCYVLAQLVGASGSVLGVDMTAEQLAVANAHLDYHAERFGFANVSFRHGYIEDLASLELADGSFDVIVSNCVINLSPDKDSVLREAYRLLKPGGELYFSDVYADRRLADELRQDEVLYGECLGGALYWNDFEHLARRHGFTDPRLVEDQPISITDSALAEKLGDARFYSATYRLFKLDGLEPACEDYGQAVIYRGSIPGAAHAFVLDKHHRIETGRVFPVCGNTWRMLQDTRFAPHFQFIGDFSRHFGLFEGCGGGLPYDRQAAVTAATSCC

38 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make arsM using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here